Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00001336-protein ID=TCONS_00001336-protein|Name=TCONS_00001336-protein|organism=Clytia hemisphaerica|type=polypeptide|length=494bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00001336-protein vs. Swiss-Prot (Human)
Match: REPS1 (RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens GN=REPS1 PE=1 SV=3) HSP 1 Score: 114.39 bits (285), Expect = 7.011e-27 Identity = 58/115 (50.43%), Postives = 76/115 (66.09%), Query Frame = 0 Query: 1 MASSSMASSIPESTSSVDSSSDNEEMRITQEQREYYTNQFKSLQPNEDDVIKGPQARDFFLKSNLAMETLSKIWHLSDLDKDGALNLEEFQIAMHLVVLIKHGYELPMVLPPSLL 115 +AS++ A I +SS D + +IT EQR+YY NQFK++QP+ + I G A++FF KS L + LS IW LSD DKDGAL L+EF A HLVV K+GY+LP LP SL+ Sbjct: 259 VASATTAIEIRRQSSSYD-----DPWKITDEQRQYYVNQFKTIQPDLNGFIPGSAAKEFFTKSKLPILELSHIWELSDFDKDGALTLDEFCAAFHLVVARKNGYDLPEKLPESLM 368 The following BLAST results are available for this feature:
BLAST of TCONS_00001336-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|