Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00002656-protein ID=TCONS_00002656-protein|Name=TCONS_00002656-protein|organism=Clytia hemisphaerica|type=polypeptide|length=101bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00002656-protein vs. Swiss-Prot (Human)
Match: MED10 (Mediator of RNA polymerase II transcription subunit 10 OS=Homo sapiens GN=MED10 PE=1 SV=1) HSP 1 Score: 99.3673 bits (246), Expect = 2.097e-28 Identity = 45/100 (45.00%), Postives = 67/100 (67.00%), Query Frame = 0 Query: 1 AQPALNTKLNDMISNMQEIDKNKNAFSDIFVPPEIFKYIDEGRNPRLYTKDCLQKVREKKEEVDSKVDAYKNFKGILEEELKKELPQTMDKHSKFKRQQH 100 +Q LN KLN +++ +Q+IDK + DI VP E+F+YID+GRNP+LYTK+CL++ K E+V K+D K FK +L +EL K P+ M K+ + + H Sbjct: 33 SQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDH 132 The following BLAST results are available for this feature:
BLAST of TCONS_00002656-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|