Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00002668-protein ID=TCONS_00002668-protein|Name=TCONS_00002668-protein|organism=Clytia hemisphaerica|type=polypeptide|length=690bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00002668-protein vs. Swiss-Prot (Human)
Match: IN80D (INO80 complex subunit D OS=Homo sapiens GN=INO80D PE=1 SV=2) HSP 1 Score: 117.857 bits (294), Expect = 3.245e-27 Identity = 49/90 (54.44%), Postives = 64/90 (71.11%), Query Frame = 0 Query: 1 MFEGKNIHLSPIDGKPLCSFSKKLCRQRRLHNYAFCIRHILEDTDSPFKQCPYQTK-SGDICINAVPVAAAREYCNKHMLIMGLQPKTTK 89 M+EGK+IH S +D KPLCS+S KLC+QRRL+ YAFCIRH+LED +PFKQC Y K + C N +P + R YCN H+ ++G PK + Sbjct: 1 MYEGKHIHFSEVDNKPLCSYSPKLCKQRRLNGYAFCIRHVLEDKTAPFKQCEYVAKYNSQRCTNPIPKSEDRRYCNSHLQVLGFIPKKER 90 The following BLAST results are available for this feature:
BLAST of TCONS_00002668-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|