Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00002796-protein ID=TCONS_00002796-protein|Name=TCONS_00002796-protein|organism=Clytia hemisphaerica|type=polypeptide|length=114bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00002796-protein vs. Swiss-Prot (Human)
Match: T23O (Tryptophan 2,3-dioxygenase OS=Homo sapiens GN=TDO2 PE=1 SV=1) HSP 1 Score: 108.612 bits (270), Expect = 2.071e-29 Identity = 54/104 (51.92%), Postives = 74/104 (71.15%), Query Frame = 0 Query: 1 KIYDQLLAKGERRLSWESFVTALTIQYQGKFGSFKNEWQLLNLLMDLDQVFMKWRFVHLSLVYRQIGVKRGTVGSSGYYYLRSTISERYHVFKDLFRLSSCLIP 104 K ++ LL+KGERRLS+ + AL I + + F+ +QLL LMD+D + KWR+ H+ +V+R +G K GT GSSGY+YLRST+S+RY VF DLF LS+ LIP Sbjct: 271 KRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIP 374 The following BLAST results are available for this feature:
BLAST of TCONS_00002796-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|