Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00003808-protein ID=TCONS_00003808-protein|Name=TCONS_00003808-protein|organism=Clytia hemisphaerica|type=polypeptide|length=119bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00003808-protein vs. Swiss-Prot (Human)
Match: DDX59 (Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens GN=DDX59 PE=1 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 4.767e-20 Identity = 35/57 (61.40%), Postives = 44/57 (77.19%), Query Frame = 0 Query: 45 DNNDDDDVVKATSAQQRWPNADEPVCVMCGKYGEYICDETDEDVCSLACKATHLKQV 101 D++ ++ VK+ S QRW EP+CV+CG+YGEYICD+TDEDVCSL CKA HL QV Sbjct: 83 DSHPSEEPVKSFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQV 139 The following BLAST results are available for this feature:
BLAST of TCONS_00003808-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|