Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00004748-protein ID=TCONS_00004748-protein|Name=TCONS_00004748-protein|organism=Clytia hemisphaerica|type=polypeptide|length=388bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00004748-protein vs. Swiss-Prot (Human)
Match: SPDEF (SAM pointed domain-containing Ets transcription factor OS=Homo sapiens GN=SPDEF PE=1 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 1.555e-21 Identity = 45/90 (50.00%), Postives = 63/90 (70.00%), Query Frame = 0 Query: 300 TGKP-RLFRFLKDILEDPNQY-KCIEWVNKSTGTFKFLDSSEVARLWGHRKNKPAMKYENFARSLRTYIAKGILKKP--RNKLVYCFAQP 385 +G+P L++FLK++L P+ Y + I W+NK G FK DS++VARLWG RKN+PAM Y+ +RS+R Y KGI++KP +LVY F P Sbjct: 245 SGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHP 334 The following BLAST results are available for this feature:
BLAST of TCONS_00004748-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|