Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00004956-protein ID=TCONS_00004956-protein|Name=TCONS_00004956-protein|organism=Clytia hemisphaerica|type=polypeptide|length=226bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00004956-protein vs. Swiss-Prot (Human)
Match: IN80E (INO80 complex subunit E OS=Homo sapiens GN=INO80E PE=1 SV=1) HSP 1 Score: 93.5893 bits (231), Expect = 2.843e-23 Identity = 43/56 (76.79%), Postives = 49/56 (87.50%), Query Frame = 0 Query: 24 NDDVNYKEKYRTLKRKLKSLLYEQECFHEELRKIQRKCLRVSRDKSFLLDRLLQYE 79 + +V+YK+KYR LKRKLK L+YE ECF EELRK QRK L+VSRDKSFLLDRLLQYE Sbjct: 6 DGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYE 61 The following BLAST results are available for this feature:
BLAST of TCONS_00004956-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|