Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00046155-protein ID=TCONS_00046155-protein|Name=TCONS_00046155-protein|organism=Clytia hemisphaerica|type=polypeptide|length=132bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00046155-protein vs. Swiss-Prot (Human)
Match: COX5B (Cytochrome c oxidase subunit 5B, mitochondrial OS=Homo sapiens GN=COX5B PE=1 SV=2) HSP 1 Score: 103.219 bits (256), Expect = 1.761e-29 Identity = 52/103 (50.49%), Postives = 70/103 (67.96%), Query Frame = 0 Query: 23 STSAAARKAVLSETIPTDLEQATGVERKELEAILGGNPDPFNMNITKGAPGTRDAPTLVPSMYEERIIGCVCEEEATTIVWMVLKKGGAQRC-KCGNFFQLVP 124 S +AA R +PTD EQATG+ER+ + A G DP+N+ KGA GTR+ P LVPS+ +RI+GC+CEE+ T++VW L KG AQRC +CG ++LVP Sbjct: 23 SGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGL-DPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVP 124 The following BLAST results are available for this feature:
BLAST of TCONS_00046155-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|