Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00046838-protein ID=TCONS_00046838-protein|Name=TCONS_00046838-protein|organism=Clytia hemisphaerica|type=polypeptide|length=161bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00046838-protein vs. Swiss-Prot (Human)
Match: FUT4 (Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens GN=FUT4 PE=2 SV=3) HSP 1 Score: 87.8113 bits (216), Expect = 7.235e-21 Identity = 43/118 (36.44%), Postives = 66/118 (55.93%), Query Frame = 0 Query: 22 AKYKFFLAVENFYCTDYVTEKFYEESLRKGLVPVMINGGKLRNRRIAPPHSYINVLDFKNAKELADYINYLDRNQTAYLEYHKWRRDYEIVPHNY----KCNLCRSINKKFNRVKRWR 135 A+YKF+LA EN DY+TEK + +L G VPV++ + R P ++I+V DF +A LA Y+ +LDRN Y Y WRR Y + ++ C +C+++ + +R K R Sbjct: 405 ARYKFYLAFENSQHLDYITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIR 522 The following BLAST results are available for this feature:
BLAST of TCONS_00046838-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|