Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00047278-protein ID=TCONS_00047278-protein|Name=paired-like homeodomain protein|organism=Clytia hemisphaerica|type=polypeptide|length=225bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of paired-like homeodomain protein vs. Swiss-Prot (Human)
Match: ARX (Homeobox protein ARX OS=Homo sapiens GN=ARX PE=1 SV=1) HSP 1 Score: 126.331 bits (316), Expect = 1.134e-33 Identity = 60/79 (75.95%), Postives = 66/79 (83.54%), Query Frame = 0 Query: 4 LSDDQDSYKNRYPNGKRKQRRYRTTFSQIQLDELERAFEKTHYPDVFMREELAMRINLTEARVQVWFQNRRAKWRKREK 82 LS DS + KRKQRRYRTTF+ QL+ELERAF+KTHYPDVF REELAMR++LTEARVQVWFQNRRAKWRKREK Sbjct: 313 LSAGSDSEEGLL---KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREK 388 The following BLAST results are available for this feature:
BLAST of paired-like homeodomain protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|