|
|
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00047474-protein ID=TCONS_00047474-protein|Name=TCONS_00047474-protein|organism=Clytia hemisphaerica|type=polypeptide|length=387bp
GNCKSACTFEYDPRCASNGRTYDNNCLLSIAHCHDSNVKFKHWGRCGTCS
EKCPRNIDYVCGSDGKTYANECELNKQRCYHDRNLRKQSPGRCVVEMEFI
VKGQLALPYQFRGNLPEESCMKVFVTKEVCGSTTSCLASVKGVLTTKQPN
IRYNQIDYQLTVNEQPGMYYLNARLYRGWCPSSRNYQLRDGDLYNRDKEI
VYFHHNDKTKKVPVIKMTYFGNPDQNQCVKHCRLVEDFVCGTDKVTYTNP
CLLAIKTCTSNGVVKKAHNGKCGKKPKGDCERTSYPYSCLRRGFYWYFDY
YLNRCMRRYGCPGSANNFVNEETCQATCAKNKCDIQCNDSLNYPVCGTNN
LTYSNRCQLKKAECEMNGRVKLAYNGKCNGHQINRHG Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
This polypeptide derives from the following transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0005515 | protein binding |
| GO:0004867 | serine-type endopeptidase inhibitor activity |
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
| Category |
Term Accession |
Term Name |
| molecular_function |
GO:0005515 |
protein binding |
| molecular_function |
GO:0004867 |
serine-type endopeptidase inhibitor activity |
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR002350 | Kazal domain | SMART | SM00280 | kazal_3 | coord: 2..46
e-value: 1.7E-10
score: 50.8
coord: 227..272
e-value: 5.2E-6
score: 36.0
coord: 48..93
e-value: 9.5E-15
score: 65.0
coord: 332..378
e-value: 4.7E-12
score: 56.1 |
| IPR002350 | Kazal domain | PFAM | PF07648 | Kazal_2 | coord: 227..272
e-value: 6.3E-8
score: 32.5
coord: 332..378
e-value: 1.0E-10
score: 41.4
coord: 49..93
e-value: 1.8E-9
score: 37.5 |
| IPR002350 | Kazal domain | PFAM | PF00050 | Kazal_1 | coord: 5..46
e-value: 1.2E-7
score: 31.5 |
| IPR002350 | Kazal domain | PROSITE | PS51465 | KAZAL_2 | coord: 48..95
score: 11.923 |
| IPR002350 | Kazal domain | PROSITE | PS51465 | KAZAL_2 | coord: 1..47
score: 11.435 |
| IPR002350 | Kazal domain | PROSITE | PS51465 | KAZAL_2 | coord: 329..380
score: 11.241 |
| IPR002350 | Kazal domain | PROSITE | PS51465 | KAZAL_2 | coord: 222..274
score: 10.282 |
| IPR002350 | Kazal domain | SUPERFAMILY | 100895 | Kazal-type serine protease inhibitors | coord: 332..380 |
| IPR002350 | Kazal domain | SUPERFAMILY | 100895 | Kazal-type serine protease inhibitors | coord: 228..274 |
| IPR002350 | Kazal domain | SUPERFAMILY | 100895 | Kazal-type serine protease inhibitors | coord: 2..46 |
| IPR002350 | Kazal domain | SUPERFAMILY | 100895 | Kazal-type serine protease inhibitors | coord: 49..93 |
| None | No IPR available | GENE3D | 3.30.60.30 | | coord: 325..378
e-value: 1.2E-11
score: 44.2 |
| None | No IPR available | GENE3D | 3.30.60.30 | | coord: 1..48
e-value: 5.0E-12
score: 45.4 |
| None | No IPR available | GENE3D | 3.30.60.30 | | coord: 219..257
e-value: 1.2E-10
score: 40.9
coord: 49..93
e-value: 1.2E-14
score: 53.7 |
| None | No IPR available | CDD | cd00104 | KAZAL_FS | coord: 7..46
e-value: 5.69357E-5
score: 39.1754 |
| None | No IPR available | CDD | cd00104 | KAZAL_FS | coord: 344..378
e-value: 1.64007E-7
score: 46.4942 |
| None | No IPR available | CDD | cd00104 | KAZAL_FS | coord: 53..93
e-value: 1.43723E-9
score: 52.2722 |
| None | No IPR available | CDD | cd00104 | KAZAL_FS | coord: 232..272
e-value: 2.83799E-6
score: 43.0274 |
| IPR002223 | Pancreatic trypsin inhibitor Kunitz domain | GENE3D | 4.10.410.10 | | coord: 258..324
e-value: 2.1E-6
score: 27.3 |
| IPR002223 | Pancreatic trypsin inhibitor Kunitz domain | PROSITE | PS50279 | BPTI_KUNITZ_2 | coord: 280..328
score: 8.724 |
| IPR002223 | Pancreatic trypsin inhibitor Kunitz domain | SUPERFAMILY | 57362 | BPTI-like | coord: 271..330 |
Blast
The following BLAST results are available for this feature:
|
