Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00049503-protein ID=TCONS_00049503-protein|Name=TCONS_00049503-protein|organism=Clytia hemisphaerica|type=polypeptide|length=598bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00049503-protein vs. Swiss-Prot (Human)
Match: ARI3A (AT-rich interactive domain-containing protein 3A OS=Homo sapiens GN=ARID3A PE=1 SV=2) HSP 1 Score: 93.9745 bits (232), Expect = 3.837e-20 Identity = 50/121 (41.32%), Postives = 73/121 (60.33%), Query Frame = 0 Query: 57 ETFLKLKEMNNELDRHLFLDDYIAFMVNTGDTEITQKIPIVGKKLLDLVDLYRLVQKHGGFEKVCQKRQLSAVVRELNLPKTITSAANTLRNQFARFLYRFECYQRGVRVNEQFLREQLDS 177 E F +L E++ + R FLDD +FM G +IPI+ K++LDL LY LV + GG +V K+ + + LNLP +ITSAA TLR Q+ ++LY +EC +RG+ N L+ +DS Sbjct: 227 EQFKQLYELDGDPKRKEFLDDLFSFMQKRGTP--VNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLS-NPNELQAAIDS 344 The following BLAST results are available for this feature:
BLAST of TCONS_00049503-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|