Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00049574-protein ID=TCONS_00049574-protein|Name=TCONS_00049574-protein|organism=Clytia hemisphaerica|type=polypeptide|length=145bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00049574-protein vs. Swiss-Prot (Human)
Match: MORN2 (MORN repeat-containing protein 2 OS=Homo sapiens GN=MORN2 PE=1 SV=2) HSP 1 Score: 82.8037 bits (203), Expect = 9.122e-22 Identity = 41/79 (51.90%), Postives = 51/79 (64.56%), Query Frame = 0 Query: 67 LNGKGKIVHPSGACYEGDVLDNMMHGQGTYVFTDKSIYEGQFNENRLEGEGQLTDPSGQVWCGMFTKDSANGLEFKLNM 145 +NG G++ H SGA YEG DNM HG GTY F + + Y G FNENR+EGEG+ TD G W G F +A L+ KL+M Sbjct: 1 MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKLHM 79 The following BLAST results are available for this feature:
BLAST of TCONS_00049574-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|