Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00050753-protein ID=TCONS_00050753-protein|Name=TCONS_00050753-protein|organism=Clytia hemisphaerica|type=polypeptide|length=168bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00050753-protein vs. Swiss-Prot (Human)
Match: TM220 (Transmembrane protein 220 OS=Homo sapiens GN=TMEM220 PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 1.205e-16 Identity = 36/107 (33.64%), Postives = 64/107 (59.81%), Query Frame = 0 Query: 34 FWRILNCIMGIFFMVAMGLQANDPDPAVWMLLYGITGAVSFSIVISPSLQGKRLWRIFVAVHFVCCLAMLAYVIMFYSHVIDKS-SNILHNEEGRELSGVILVQLWL 139 WR N +M FF +A +Q NDPD VW+++Y I ++ + ++P + G +W+ A+H + C + + S+++ ++ NILH EEGRELSG++++ W+ Sbjct: 5 LWRACNGLMAAFFALAALVQVNDPDAEVWVVVYTIPAVLTLLVGLNPEVTGNVIWKSISAIHILFC---TVWAVGLASYLLHRTQQNILHEEEGRELSGLVIITAWI 108 The following BLAST results are available for this feature:
BLAST of TCONS_00050753-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|