Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00050992-protein ID=TCONS_00050992-protein|Name=TCONS_00050992-protein|organism=Clytia hemisphaerica|type=polypeptide|length=317bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00050992-protein vs. Swiss-Prot (Human)
Match: LC7L2 (Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens GN=LUC7L2 PE=1 SV=2) HSP 1 Score: 127.487 bits (319), Expect = 9.819e-34 Identity = 54/86 (62.79%), Postives = 75/86 (87.21%), Query Frame = 0 Query: 2 KIMADVEELKNQKRKAEEAYRNAVPATQNQQQKLRVCEICAAFLSLYDNDRRLADHFGGRLHMGFIAVRDRLEELKAIVEKKRESR 87 K+M +VE+ + +KR+AEE YRN++PA+ QQQKLRVCE+C+A+L L+DNDRRLADHFGG+LH+GFI +R++LEELK +V +K+E R Sbjct: 154 KVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEELKRVVAEKQEKR 239 The following BLAST results are available for this feature:
BLAST of TCONS_00050992-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|