Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00051821-protein ID=TCONS_00051821-protein|Name=TCONS_00051821-protein|organism=Clytia hemisphaerica|type=polypeptide|length=99bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00051821-protein vs. Swiss-Prot (Human)
Match: TIM16 (Mitochondrial import inner membrane translocase subunit TIM16 OS=Homo sapiens GN=PAM16 PE=1 SV=2) HSP 1 Score: 98.2117 bits (243), Expect = 4.998e-28 Identity = 46/70 (65.71%), Postives = 59/70 (84.29%), Query Frame = 0 Query: 14 GTKKAASNNAATGISLDEAKQILNIKELNPEEVQKSYDYLFKINDKKAGGSFYLQSKVFRAKERLDMEFK 83 G + AA++N +G+SL EA+QILN+ +L+PEEVQK+Y++LFK+NDK GGSFYLQSKV RAKERLD E K Sbjct: 42 GHRSAAASNL-SGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELK 110 The following BLAST results are available for this feature:
BLAST of TCONS_00051821-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|