Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00052369-protein ID=TCONS_00052369-protein|Name=Antp family homeodomain transcription factor protein HD01|organism=Clytia hemisphaerica|type=polypeptide|length=240bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Antp family homeodomain transcription factor protein HD01 vs. Swiss-Prot (Human)
Match: VAX1 (Ventral anterior homeobox 1 OS=Homo sapiens GN=VAX1 PE=1 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 5.203e-17 Identity = 39/70 (55.71%), Postives = 49/70 (70.00%), Query Frame = 0 Query: 172 KRHRTIFTPSQLRKLEEKFIECNFIVGVDRSALAKQLKLKEHQVKIWFQNRRTKVKQ-QGKEKSEIDVVS 240 KR RT FT QL +LE +F C ++VG +R+ LA+QL L E QVK+WFQNRRTK K+ QGK+ VVS Sbjct: 101 KRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVS 170 The following BLAST results are available for this feature:
BLAST of Antp family homeodomain transcription factor protein HD01 vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|