Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00054478-protein ID=TCONS_00054478-protein|Name=TCONS_00054478-protein|organism=Clytia hemisphaerica|type=polypeptide|length=387bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00054478-protein vs. Swiss-Prot (Human)
Match: INSM2 (Insulinoma-associated protein 2 OS=Homo sapiens GN=INSM2 PE=1 SV=3) HSP 1 Score: 102.834 bits (255), Expect = 7.556e-24 Identity = 43/65 (66.15%), Postives = 51/65 (78.46%), Query Frame = 0 Query: 134 PLNQSSFNCQLCKLSFCDPLSLAQHKCSKIKHVEHRCPECDKVFNCPANLASHRRWHRPRSPTTN 198 PL + F CQLCK + DP +LAQH+CS+I VE+RCPECDKVF+CPANLASHRRWH+PR N Sbjct: 259 PLGE--FICQLCKEQYADPFALAQHRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPAAAN 321 The following BLAST results are available for this feature:
BLAST of TCONS_00054478-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|