Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057147-protein ID=TCONS_00057147-protein|Name=Nanos1|organism=Clytia hemisphaerica|type=polypeptide|length=243bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Nanos1 vs. Swiss-Prot (Human)
Match: NANO2 (Nanos homolog 2 OS=Homo sapiens GN=NANOS2 PE=1 SV=1) HSP 1 Score: 85.5001 bits (210), Expect = 5.439e-21 Identity = 35/60 (58.33%), Postives = 42/60 (70.00%), Query Frame = 0 Query: 163 NAAKATVCVFCRNNGESREFYSSHTLKDSEGNTSCPILRAYTCPLCKANGDSSHTVKYCP 222 N T+C FC++NGESR YSSH LK +G CPILR Y CP+C A GD +HT+KYCP Sbjct: 56 NGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCP 115 The following BLAST results are available for this feature:
BLAST of Nanos1 vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|