Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057747-protein ID=TCONS_00057747-protein|Name=TCONS_00057747-protein|organism=Clytia hemisphaerica|type=polypeptide|length=220bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00057747-protein vs. Swiss-Prot (Human)
Match: TMM18 (Transmembrane protein 18 OS=Homo sapiens GN=TMEM18 PE=1 SV=2) HSP 1 Score: 87.8113 bits (216), Expect = 3.283e-22 Identity = 43/105 (40.95%), Postives = 63/105 (60.00%), Query Frame = 0 Query: 96 WRENWMLCLMMFHLTCLLLITISRKSANLQYCIFFLLLCCVYFSERLNELAADNHKRFASENFFDSSGLFISTVFSIPVLFNCIVLIVMWLSSAARTLIDVKQRQ 200 W E W++ L FH C+LL +S +S LQ F L+ VY +E +NE AA N + F+ +FDS G+FIS VFS P+L N ++++VMW+ + D+K Q Sbjct: 23 WTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQ 127 The following BLAST results are available for this feature:
BLAST of TCONS_00057747-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|