Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057787-protein ID=TCONS_00057787-protein|Name=TCONS_00057787-protein|organism=Clytia hemisphaerica|type=polypeptide|length=245bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00057787-protein vs. Swiss-Prot (Human)
Match: SULF2 (Extracellular sulfatase Sulf-2 OS=Homo sapiens GN=SULF2 PE=1 SV=1) HSP 1 Score: 130.568 bits (327), Expect = 1.708e-34 Identity = 51/98 (52.04%), Postives = 69/98 (70.41%), Query Frame = 0 Query: 94 MNCFSMSKKHWKTPPYWTGPEFVACTNTANSTYWCLRTINSTHNFLYCEYWTGFVEYFDMQTDPYQLYNKADNMTADFQKELSSQLQYMRKCRGAKEC 191 + CF+ +HW+T P+WT F ACT+ N+TYWC+RTIN THNFL+CE+ TGF+EYFD+ TDPYQL N + + D +L QL +R C+G K+C Sbjct: 725 LTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQC 822 The following BLAST results are available for this feature:
BLAST of TCONS_00057787-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|