Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00058274-protein ID=TCONS_00058274-protein|Name=TCONS_00058274-protein|organism=Clytia hemisphaerica|type=polypeptide|length=104bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00058274-protein vs. Swiss-Prot (Human)
Match: THIO (Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3) HSP 1 Score: 91.2781 bits (225), Expect = 1.970e-25 Identity = 41/104 (39.42%), Postives = 68/104 (65.38%), Query Frame = 0 Query: 1 MVTLVKTKTEFDSTL--SNNPLVAVDFTASWCGPCKMIGPKFEAMAAQFPSIKFIKVDVDENSETSEALGIAAMPTFFFYANGEKMKEVVGASEDKLREALQEL 102 MV +++KT F L + + LV VDF+A+WCGPCKMI P F +++ ++ ++ F++VDVD+ + + + MPTF F+ G+K+ E GA+++KL + EL Sbjct: 1 MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINEL 104 The following BLAST results are available for this feature:
BLAST of TCONS_00058274-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|