Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00059074-protein ID=TCONS_00059074-protein|Name=TCONS_00059074-protein|organism=Clytia hemisphaerica|type=polypeptide|length=137bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00059074-protein vs. Swiss-Prot (Human)
Match: NDUA8 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens GN=NDUFA8 PE=1 SV=3) HSP 1 Score: 114.775 bits (286), Expect = 2.020e-33 Identity = 55/113 (48.67%), Postives = 75/113 (66.37%), Query Frame = 0 Query: 14 MVDRIEFKELETEEVPVTSAVLLGAAHHLGTYCNKDFTTFVQKRFETKDPRATLDEGKAVTNCALEFFRKLKAACNKEFTDHWTCLDY-NNQYYGQCRKTQKVYDECVLKNLG 125 +V+ +EL+ +EV ++SAVL AAHH G C+K F+ R+E KDPR L+EGK V CAL+FFR++K C + FT++WTC+DY Q + CRK Q +DECVL LG Sbjct: 4 IVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLG 116 The following BLAST results are available for this feature:
BLAST of TCONS_00059074-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|