Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00061684-protein ID=TCONS_00061684-protein|Name=TCONS_00061684-protein|organism=Clytia hemisphaerica|type=polypeptide|length=746bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00061684-protein vs. Swiss-Prot (Human)
Match: SPAT1 (Spermatogenesis-associated protein 1 OS=Homo sapiens GN=SPATA1 PE=2 SV=3) HSP 1 Score: 88.1965 bits (217), Expect = 1.948e-18 Identity = 45/107 (42.06%), Postives = 64/107 (59.81%), Query Frame = 0 Query: 8 SLELVYLHVFVVPLELWLDQYRFAYKNAVLESLSAGFIRVAPKTSLSSTRHHIRNQLELDIIPKDFIYLRTVGRCLAVVSEQQEVEMRAREFAPPATSSPELLLLPI 114 S ELV LHVF VP W + V + +SAGF+RV+P+ +L + R + L D I + F++L+ +G LAVV E+QE E++ + FAPP PEL LLP+ Sbjct: 10 SSELVELHVFYVPEGSWNYKLNTISTEVVNKFISAGFLRVSPQLTLRALRERLGEFLGEDAIAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLLPV 116 The following BLAST results are available for this feature:
BLAST of TCONS_00061684-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|