Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00063733-protein ID=TCONS_00063733-protein|Name=TCONS_00063733-protein|organism=Clytia hemisphaerica|type=polypeptide|length=104bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00063733-protein vs. Swiss-Prot (Human)
Match: CHIT1 (Chitotriosidase-1 OS=Homo sapiens GN=CHIT1 PE=1 SV=1) HSP 1 Score: 107.842 bits (268), Expect = 4.723e-29 Identity = 45/77 (58.44%), Postives = 57/77 (74.03%), Query Frame = 0 Query: 24 VCYYTNWAQYRPAPMKFFPEDIDPNLCTHVIYAFAKLGRNSELAMYEWNDDKMYPRVMALKKKNPALKVLLAVGGWN 100 VCY+TNWAQYR +F P+D+DP+LCTH+IYAFA + N +L+ EWND+ +Y LKK NP LK LLA+GGWN Sbjct: 25 VCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGM-TNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWN 100 The following BLAST results are available for this feature:
BLAST of TCONS_00063733-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|