Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00064730-protein ID=TCONS_00064730-protein|Name=TCONS_00064730-protein|organism=Clytia hemisphaerica|type=polypeptide|length=495bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00064730-protein vs. Swiss-Prot (Human)
Match: CFDP1 (Craniofacial development protein 1 OS=Homo sapiens GN=CFDP1 PE=1 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 9.559e-16 Identity = 46/118 (38.98%), Postives = 72/118 (61.02%), Query Frame = 0 Query: 376 KPISSTSSSTANSIANNNEIKPTLPKGVAAASNSLPKGLGAFQKGGGLSSIVGSMKEKK-KTSILDQSKSDWNSFKNDEGLEDELKANRNA--GYLDKQEFLQRVDYKQWENEREMRL 490 K + +TS + N + KP V +A SLP G G ++ G+SS++G + KK K S L++SK DW SFK +EG+ +EL + GY++++ FL RVD++Q+E ER++RL Sbjct: 180 KEVDATSKEAKSFFKQNEKEKPQ--ANVPSALPSLPAGSG-LKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRL 294 The following BLAST results are available for this feature:
BLAST of TCONS_00064730-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|