Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00065268-protein ID=TCONS_00065268-protein|Name=SOX2|organism=Clytia hemisphaerica|type=polypeptide|length=496bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of SOX2 vs. Swiss-Prot (Human)
Match: SOX14 (Transcription factor SOX-14 OS=Homo sapiens GN=SOX14 PE=1 SV=1) HSP 1 Score: 132.88 bits (333), Expect = 9.549e-36 Identity = 56/79 (70.89%), Postives = 73/79 (92.41%), Query Frame = 0 Query: 37 NHIKRPMNSFMVWSRMERKRISEENPKLHNSEISKRLGASWKMLSEEERKPFAEEAKRLRQIHIQEHPEYKYRPRRKPK 115 +HIKRPMN+FMVWSR +R+++++ENPK+HNSEISKRLGA WK+LSE E++P+ +EAKRLR H++EHP+YKYRPRRKPK Sbjct: 6 DHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPK 84 The following BLAST results are available for this feature:
BLAST of SOX2 vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|