Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00067153-protein ID=TCONS_00067153-protein|Name=TCONS_00067153-protein|organism=Clytia hemisphaerica|type=polypeptide|length=120bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00067153-protein vs. Swiss-Prot (Human)
Match: RIAD1 (RIIa domain-containing protein 1 OS=Homo sapiens GN=RIIAD1 PE=4 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 1.184e-24 Identity = 42/85 (49.41%), Postives = 60/85 (70.59%), Query Frame = 0 Query: 29 IEKNDIGALTDDQQSKLNSFKIKTRMGNEKYLREHPEIDCLISSFVSEVCIQRPNNVREFAADYFTDPDL--KLKVQALVQKKES 111 +++ D GAL+ Q +L FKI+TR+ NEKYLR H E++ LIS F E+ ++RP+N+ EFAADYFTDP L K+ +Q + KK + Sbjct: 8 LQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIHMQLIKDKKAA 92 The following BLAST results are available for this feature:
BLAST of TCONS_00067153-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|