Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00070201-protein ID=TCONS_00070201-protein|Name=TCONS_00070201-protein|organism=Clytia hemisphaerica|type=polypeptide|length=304bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00070201-protein vs. Swiss-Prot (Human)
Match: XBP1 (X-box-binding protein 1 OS=Homo sapiens GN=XBP1 PE=1 SV=2) HSP 1 Score: 84.3445 bits (207), Expect = 4.740e-19 Identity = 44/81 (54.32%), Postives = 61/81 (75.31%), Query Frame = 0 Query: 33 RKRRRLDNLNVEERILRRKLKNRVAAQSARDRKKAHMDQLEITLMRVEKENKFLKKSNEELRSQVHQLMENNAQLRSKLGL 113 RKR+RL +L+ EE+ LRRKLKNRVAAQ+ARDRKKA M +LE ++ +E+EN+ L N+ LR + H L+ N +LR +LG+ Sbjct: 59 RKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGM 139 The following BLAST results are available for this feature:
BLAST of TCONS_00070201-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|