Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00070249-protein ID=TCONS_00070249-protein|Name=NK2d homeodomain transcription factor protein|organism=Clytia hemisphaerica|type=polypeptide|length=287bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of NK2d homeodomain transcription factor protein vs. Swiss-Prot (Human)
Match: NKX21 (Homeobox protein Nkx-2.1 OS=Homo sapiens GN=NKX2-1 PE=1 SV=1) HSP 1 Score: 98.5969 bits (244), Expect = 1.092e-23 Identity = 42/61 (68.85%), Postives = 52/61 (85.25%), Query Frame = 0 Query: 65 KKRRILFTRQQTWELERIFRQQPYLSSPEREVLAKKINLTPTQIKIWFQNHRYKMKKYMKD 125 +KRR+LF++ Q +ELER F+QQ YLS+PERE LA I+LTPTQ+KIWFQNHRYKMK+ KD Sbjct: 162 RKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 222 The following BLAST results are available for this feature:
BLAST of NK2d homeodomain transcription factor protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|