Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00071068-protein ID=TCONS_00071068-protein|Name=Dmrt-E Doublesex and mab-3 related trasncription factor|organism=Clytia hemisphaerica|type=polypeptide|length=347bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Dmrt-E Doublesex and mab-3 related trasncription factor vs. Swiss-Prot (Human)
Match: DMRT2 (Doublesex- and mab-3-related transcription factor 2 OS=Homo sapiens GN=DMRT2 PE=2 SV=2) HSP 1 Score: 86.6557 bits (213), Expect = 1.110e-18 Identity = 39/85 (45.88%), Postives = 47/85 (55.29%), Query Frame = 0 Query: 22 PFNDATSPTPSGTAATSPTHDASKQPSNNSRAPKCTRCRNHGVISDLRGHKHKCYWRDCSCTKCLISSDRQRATADRIALFRQQV 106 P SP +G +P SR PKC RCRNHGV+S L+GHK C WRDC C CL+ +RQR A ++AL RQQ Sbjct: 89 PLAPQASPAGTGPRERCTPAGGGAEPRKLSRTPKCARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQQA 173 The following BLAST results are available for this feature:
BLAST of Dmrt-E Doublesex and mab-3 related trasncription factor vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|