Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00071290-protein ID=TCONS_00071290-protein|Name=TCONS_00071290-protein|organism=Clytia hemisphaerica|type=polypeptide|length=99bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00071290-protein vs. Swiss-Prot (Human)
Match: MGST3 (Microsomal glutathione S-transferase 3 OS=Homo sapiens GN=MGST3 PE=1 SV=1) HSP 1 Score: 112.079 bits (279), Expect = 3.391e-33 Identity = 51/99 (51.52%), Postives = 68/99 (68.69%), Query Frame = 0 Query: 1 MYSSDNEKEGKIFNCIQRAHQNTLEVYAPTMMVMLLGGIKHPMLCAGSGAVWLFSRLVYAHGYYTGDPAKRSRGAFGYLGLFTMYGCTISLGLSMLGMI 99 MYS+D E G IFNCIQRAHQNTLEVY P + + +GG+ HP + +G G W+ R++YA+GYYTG+P+KRSRGA G + L + G T+ LG + Sbjct: 43 MYSTDPE-NGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWV 140 The following BLAST results are available for this feature:
BLAST of TCONS_00071290-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|