Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00006316 ID=TCONS_00006316|Name=TCONS_00006316|organism=Clytia hemisphaerica|type=transcript|length=335bpRun BLAST on NCBI transcript from alignment at sc0000066:593263..593927- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00006316 ID=TCONS_00006316|Name=TCONS_00006316|organism=Clytia hemisphaerica|type=transcript|length=665bp|location=Sequence derived from alignment at sc0000066:593263..593927- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00006316 vs. Swiss-Prot (Human)
Match: ABCA2 (ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3) HSP 1 Score: 82.8037 bits (203), Expect = 8.061e-19 Identity = 43/84 (51.19%), Postives = 55/84 (65.48%), Query Frame = 2 Query: 77 YEKEQRLKEVMKMMGLSNTVSFIYSVAILVQSIVYEKEQRLKEVMKMMGLSNTVHWAAWFITSIVGMXXXXXXXXXXXKTGHIL 328 Y ++ L + MM L +S++YSVA+ +Q IV EKE RLKEVMK MGL+N VHW AWFIT V + V LT +LK G +L Sbjct: 694 YTRDDFLFVIEHMMPLCMVISWVYSVAMTIQHIVAEKEHRLKEVMKTMGLNNAVHWVAWFITGFVQLSISVTALTAILKYGQVL 777 The following BLAST results are available for this feature:
BLAST of TCONS_00006316 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|