Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00046751 ID=TCONS_00046751|Name=TCONS_00046751|organism=Clytia hemisphaerica|type=transcript|length=272bpRun BLAST on NCBI transcript from alignment at scaffold_116:666168..666439 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00046751 ID=TCONS_00046751|Name=TCONS_00046751|organism=Clytia hemisphaerica|type=transcript|length=272bp|location=Sequence derived from alignment at scaffold_116:666168..666439 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00046751 vs. Swiss-Prot (Human)
Match: TENX (Tenascin-X OS=Homo sapiens GN=TNXB PE=1 SV=4) HSP 1 Score: 85.5001 bits (210), Expect = 5.462e-20 Identity = 39/90 (43.33%), Postives = 56/90 (62.22%), Query Frame = 3 Query: 3 RVDGTTNFFRNWKTYKEGFGQLQHEHWLGNDNLHLLTAQSVLTGSEVRFDLQYKDSTSWNYAKYSTFHIDGESNAYQLHIYGYSGNAGDS 272 R+DG T+F+R+W+ Y GFG + E WLGN+ LH LT + +R DL+ D +A+Y +FH+D + Y+LH+ GY G AGDS Sbjct: 4073 RMDGQTDFWRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYS---MRVDLRAGDEAV--FAQYDSFHVDSAAEYYRLHLEGYHGTAGDS 4157 The following BLAST results are available for this feature:
BLAST of TCONS_00046751 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|