Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00051198 ID=TCONS_00051198|Name=TCONS_00051198|organism=Clytia hemisphaerica|type=transcript|length=319bpRun BLAST on NCBI transcript from alignment at scaffold_2:498756..499300- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00051198 ID=TCONS_00051198|Name=TCONS_00051198|organism=Clytia hemisphaerica|type=transcript|length=545bp|location=Sequence derived from alignment at scaffold_2:498756..499300- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00051198 vs. Swiss-Prot (Human)
Match: EXOG (Nuclease EXOG, mitochondrial OS=Homo sapiens GN=EXOG PE=1 SV=2) HSP 1 Score: 105.916 bits (263), Expect = 4.435e-28 Identity = 48/83 (57.83%), Postives = 64/83 (77.11%), Query Frame = 1 Query: 1 SGFARGHMVPASDVKKSQESMQETFYLTNILPQDFENNGGFWYRMENYCRSLTNRFTDVYVISGPLFLSHFVQN-KKMVTFQV 246 SG++RGHM PA + K S ++M ETFYL+NI+PQDF+NN G+W R+E YCR LT RF DV+V+SGPL L + KK+V++QV Sbjct: 134 SGWSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGKKIVSYQV 216 The following BLAST results are available for this feature:
BLAST of TCONS_00051198 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|