Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00052349 ID=TCONS_00052349|Name=TCONS_00052349|organism=Clytia hemisphaerica|type=transcript|length=298bpRun BLAST on NCBI transcript from alignment at scaffold_213:532357..533006- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00052349 ID=TCONS_00052349|Name=TCONS_00052349|organism=Clytia hemisphaerica|type=transcript|length=650bp|location=Sequence derived from alignment at scaffold_213:532357..533006- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00052349 vs. Swiss-Prot (Human)
Match: WDR1 (WD repeat-containing protein 1 OS=Homo sapiens GN=WDR1 PE=1 SV=4) HSP 1 Score: 97.4413 bits (241), Expect = 1.562e-24 Identity = 48/98 (48.98%), Postives = 64/98 (65.31%), Query Frame = 3 Query: 3 HSNFVNVCRFSPDGSKYVTAGADGKAFIYDGKTGELIGELNEPSGRIHKGGVYGVAWSADSKKLMTCSADKTVKIWNLSERNYISNKEETVFEMGSAV 296 HS FVN RFSPDG+++ TA ADG+ +IYDGKTGE + L + H GG+Y ++WS DS L++ S DKT KIW++S + +S F MGS V Sbjct: 188 HSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALG--GSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVST-----FPMGSTV 278 The following BLAST results are available for this feature:
BLAST of TCONS_00052349 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|