Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00055463 ID=TCONS_00055463|Name=TCONS_00055463|organism=Clytia hemisphaerica|type=transcript|length=3716bpRun BLAST on NCBI transcript from alignment at scaffold_253:1294599..1315755+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00055463 ID=TCONS_00055463|Name=TCONS_00055463|organism=Clytia hemisphaerica|type=transcript|length=21157bp|location=Sequence derived from alignment at scaffold_253:1294599..1315755+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00055463 vs. Swiss-Prot (Human)
Match: SAFB1 (Scaffold attachment factor B1 OS=Homo sapiens GN=SAFB PE=1 SV=4) HSP 1 Score: 107.071 bits (266), Expect = 3.138e-23 Identity = 47/75 (62.67%), Postives = 59/75 (78.67%), Query Frame = 1 Query: 529 RCLWISGLSSITKAVDLKELFSAHGKVIGAKVVTSAKTPGSQCFGFVTMTTPAEALVCIEKVHKTVLHEKTIEVE 753 R W+SGLSS T+A DLK LFS +GKV+GAKVVT+A++PG++C+GFVTM+T EA CI +HKT LH K I VE Sbjct: 406 RNFWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCINHLHKTELHGKMISVE 480 The following BLAST results are available for this feature:
BLAST of TCONS_00055463 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|