Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00055828 ID=TCONS_00055828|Name=TCONS_00055828|organism=Clytia hemisphaerica|type=transcript|length=482bpRun BLAST on NCBI transcript from alignment at scaffold_260:12204..12685 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00055828 ID=TCONS_00055828|Name=TCONS_00055828|organism=Clytia hemisphaerica|type=transcript|length=482bp|location=Sequence derived from alignment at scaffold_260:12204..12685 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00055828 vs. Swiss-Prot (Human)
Match: MTF1 (Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2) HSP 1 Score: 86.2705 bits (212), Expect = 1.275e-19 Identity = 35/81 (43.21%), Postives = 51/81 (62.96%), Query Frame = 3 Query: 210 ESKAFSCTIDGCNRTYKTKGNLKTHMKIHSGEFSFYCDYEGCEKGFVSAYSFKVHYRHHTGIVQNIDCSIFHSDSLFQIMY 452 E K + CT +GC RTY T GNL+TH K H GE++F C+ EGC K F+++YS ++H R HT + +C + + F +Y Sbjct: 136 EVKRYQCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKAFLTSYSLRIHVRVHTK-EKPFECDVQGCEKAFNTLY 215 The following BLAST results are available for this feature:
BLAST of TCONS_00055828 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|