Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00062659 ID=TCONS_00062659|Name=TCONS_00062659|organism=Clytia hemisphaerica|type=transcript|length=331bpRun BLAST on NCBI transcript from alignment at scaffold_370:277978..278308 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00062659 ID=TCONS_00062659|Name=TCONS_00062659|organism=Clytia hemisphaerica|type=transcript|length=331bp|location=Sequence derived from alignment at scaffold_370:277978..278308 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00062659 vs. Swiss-Prot (Human)
Match: DUS1L (tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS1L PE=1 SV=1) HSP 1 Score: 91.2781 bits (225), Expect = 2.364e-22 Identity = 42/77 (54.55%), Postives = 53/77 (68.83%), Query Frame = -3 Query: 51 EGYKFYKEVLGSPKHVLAPMVDQSELPFRKMSRELGVHLCYTPMWHAGIFSRDPKYRK--LVIEHCPDDRPLLFQVC 275 +G++F+ L +HV+APMVDQSEL +R +SR G LCYTPM HA +F RD YRK L E CP+DRPL+ Q C Sbjct: 5 QGFEFWSRTLRGARHVVAPMVDQSELAWRLLSRRHGAQLCYTPMLHAQVFVRDANYRKENLYCEVCPEDRPLIVQFC 81 The following BLAST results are available for this feature:
BLAST of TCONS_00062659 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|