Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00067948 ID=TCONS_00067948|Name=TCONS_00067948|organism=Clytia hemisphaerica|type=transcript|length=304bpRun BLAST on NCBI protein sequence of TCONS_00067948-protein >TCONS_00067948-protein ID=TCONS_00067948-protein|Name=TCONS_00067948-protein|organism=Clytia hemisphaerica|type=polypeptide|length=101bp TIIPRDRRVLMRKRLKLKKRKSTQKIHQKLMDIELKLQKSYSNERKNQETRun BLAST on NCBI transcript from alignment at scaffold_477:153079..153382 Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00067948 ID=TCONS_00067948|Name=TCONS_00067948|organism=Clytia hemisphaerica|type=transcript|length=304bp|location=Sequence derived from alignment at scaffold_477:153079..153382 (Clytia hemisphaerica) Coding sequence (CDS) from alignment at scaffold_477:153079..153382 >TCONS_00067948 ID=TCONS_00067948|Name=TCONS_00067948|organism=Clytia hemisphaerica|type=CDS|length=303bp|location=Sequence derived from alignment at scaffold_477:153079..153382 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00067948 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 0
|