Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00071238 ID=TCONS_00071238|Name=TCONS_00071238|organism=Clytia hemisphaerica|type=transcript|length=2416bpRun BLAST on NCBI transcript from alignment at scaffold_60:365308..376287+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00071238 ID=TCONS_00071238|Name=TCONS_00071238|organism=Clytia hemisphaerica|type=transcript|length=10980bp|location=Sequence derived from alignment at scaffold_60:365308..376287+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00071238 vs. Swiss-Prot (Human)
Match: ARI3B (AT-rich interactive domain-containing protein 3B OS=Homo sapiens GN=ARID3B PE=1 SV=2) HSP 1 Score: 98.9821 bits (245), Expect = 1.918e-21 Identity = 39/102 (38.24%), Postives = 66/102 (64.71%), Query Frame = 1 Query: 1954 LSKVYDVIQDEEKRNFFDKYLAFMSVNGTPVTKLPVIGNKALDLYSLFRSVCERGGIQQVMEKRIFKEILTCLTLPAEDATVAYMLKAQYMTYLHAYELKAK 2259 +K+Y++ D E++ F D FM GTP+ ++P++ + LDLY L++ V E+GG+ +++ K+I++EI L LP + A+ L+ QYM YL+AYE + K Sbjct: 206 FAKLYELDGDPERKEFLDDLFVFMQKRGTPINRIPIMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLYAYECEKK 307 The following BLAST results are available for this feature:
BLAST of TCONS_00071238 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|