Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00002257-protein ID=TCONS_00002257-protein|Name=TCONS_00002257-protein|organism=Clytia hemisphaerica|type=polypeptide|length=134bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00002257-protein vs. Swiss-Prot (Human)
Match: THIOM (Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2 PE=1 SV=2) HSP 1 Score: 100.908 bits (250), Expect = 4.297e-28 Identity = 44/121 (36.36%), Postives = 77/121 (63.64%), Query Frame = 0 Query: 10 RTMFSPMITAARRMLTIDITSPQEFDEKVLKSEVPVIIDFHATWCGPCKQMDPTLKSVIQNYEGKINLVKVDVDELQDLAMEYDVMSIPYLVGLNKGKIVQTAVGAKPQDQIIQFVDDVLA 130 RT+++ I+ + T +I +F ++V+ SE PV++DFHA WCGPCK + P L+ ++ GK+ + KVD+D+ DLA+EY+V ++P ++ + G +V VG K +DQ+ F+ ++ Sbjct: 50 RTIYTTRIS----LTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 166 The following BLAST results are available for this feature:
BLAST of TCONS_00002257-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|