Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00047310-protein ID=TCONS_00047310-protein|Name=TCONS_00047310-protein|organism=Clytia hemisphaerica|type=polypeptide|length=207bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00047310-protein vs. Swiss-Prot (Human)
Match: HMX3 (Homeobox protein HMX3 OS=Homo sapiens GN=HMX3 PE=1 SV=1) HSP 1 Score: 94.3597 bits (233), Expect = 5.008e-23 Identity = 47/98 (47.96%), Postives = 63/98 (64.29%), Query Frame = 0 Query: 46 TSSVDDFKNISSTDESGSNTSPPRKKKSRTVFTRQQIQHLENAFDRKKYFTNSERQKLATDLMLSETQVKIWLQNRRNKWKKQLQTDL---NYNHGKS 140 T +D+K + + E RKKK+RTVF+R Q+ LE+ FD K+Y ++SER LA L L+ETQVKIW QNRRNKWK+QL +L N +H + Sbjct: 206 TPGAEDWKKGAESPEKKPAC---RKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQLAAELEAANLSHAAA 300 The following BLAST results are available for this feature:
BLAST of TCONS_00047310-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|