Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00052370-protein ID=TCONS_00052370-protein|Name=TCONS_00052370-protein|organism=Clytia hemisphaerica|type=polypeptide|length=119bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00052370-protein vs. Swiss-Prot (Human)
Match: RNF44 (RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 5.859e-21 Identity = 38/78 (48.72%), Postives = 53/78 (67.95%), Query Frame = 0 Query: 42 NNEPKGLSQRELDKLPSYHVTKKTLEEFNENDRCVVCMSEYEVEEKLRVLPCAHEFHAPCVDKWLMTNPTCPICRASV 119 + +P+GL++ ++++LPSY + + +E CVVC S++E + LRVLPC HEFH CVDKWL N TCPICRA Sbjct: 349 DAKPRGLTKADIEQLPSYRFNPDSHQ--SEQTLCVVCFSDFEARQLLRVLPCNHEFHTKCVDKWLKANRTCPICRADA 424 The following BLAST results are available for this feature:
BLAST of TCONS_00052370-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|