Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00055442-protein ID=TCONS_00055442-protein|Name=TCONS_00055442-protein|organism=Clytia hemisphaerica|type=polypeptide|length=106bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00055442-protein vs. Swiss-Prot (Human)
Match: CISD1 (CDGSH iron-sulfur domain-containing protein 1 OS=Homo sapiens GN=CISD1 PE=1 SV=1) HSP 1 Score: 89.7373 bits (221), Expect = 9.733e-25 Identity = 33/57 (57.89%), Postives = 47/57 (82.46%), Query Frame = 0 Query: 48 DKAKVVNSYDIEDLGDKVAFCRCWKSKKFPYCDGTHNAHNKLTGDNLGPVCLSRKES 104 D K+V+++D+EDLGDK +CRCW+SKKFP+CDG H HN+ TGDN+GP+ + +KE+ Sbjct: 52 DNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET 108 The following BLAST results are available for this feature:
BLAST of TCONS_00055442-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|