Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00056311-protein ID=TCONS_00056311-protein|Name=TCONS_00056311-protein|organism=Clytia hemisphaerica|type=polypeptide|length=132bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00056311-protein vs. Swiss-Prot (Human)
Match: BGLR (Beta-glucuronidase OS=Homo sapiens GN=GUSB PE=1 SV=2) HSP 1 Score: 93.9745 bits (232), Expect = 2.288e-23 Identity = 41/74 (55.41%), Postives = 55/74 (74.32%), Query Frame = 0 Query: 1 MYTEDYQVAAVKSYFPLFDEYKKSYFVGEMIWNFADFATAQGTTRVAGNKKGLFTRSRQPKRIAYVIRERYRKM 74 M+TE+YQ + ++ Y D+ ++ Y VGE+IWNFADF T Q TRV GNKKG+FTR RQPK A+++RERY K+ Sbjct: 556 MFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTRVLGNKKGIFTRQRQPKSAAFLLRERYWKI 629 The following BLAST results are available for this feature:
BLAST of TCONS_00056311-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|