Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00056879-protein ID=TCONS_00056879-protein|Name=TCONS_00056879-protein|organism=Clytia hemisphaerica|type=polypeptide|length=115bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00056879-protein vs. Swiss-Prot (Human)
Match: ALKB1 (Nucleic acid dioxygenase ALKBH1 OS=Homo sapiens GN=ALKBH1 PE=1 SV=2) HSP 1 Score: 93.5893 bits (231), Expect = 6.444e-24 Identity = 43/86 (50.00%), Postives = 62/86 (72.09%), Query Frame = 0 Query: 11 DYYAETGIINYYPEGASMGGHTDHYEEELCQPLISYSFGQSAIYLIGGPTRDVKPEAIWVRSGDIMLMTGPSRVAFHAVPCIITKP 96 D+ AE GI+NYY +++G H D E + +PL+S+SFGQSAI+L+GG RD P A+++ SGDIM+M+G SR+ HAVP ++ P Sbjct: 211 DFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNP 296 The following BLAST results are available for this feature:
BLAST of TCONS_00056879-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|