Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00069318-protein ID=TCONS_00069318-protein|Name=TCONS_00069318-protein|organism=Clytia hemisphaerica|type=polypeptide|length=104bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00069318-protein vs. Swiss-Prot (Human)
Match: VP33B (Vacuolar protein sorting-associated protein 33B OS=Homo sapiens GN=VPS33B PE=1 SV=2) HSP 1 Score: 86.6557 bits (213), Expect = 2.558e-21 Identity = 37/94 (39.36%), Postives = 63/94 (67.02%), Query Frame = 0 Query: 1 MKGMKRKCQVIFTPTKLSTCDIILEQEGIYGDL--EEFNLDLIRLDTDVVTMEMPLYFKQFFLDNDTTWYHSIARALSSIQGTFGTIPKAHLIG 92 + G RK +VIF+P K C+++LE+EGIYGD+ +E+ L+ LD D+++ME+P +F+ +FL+ D W +++A+AL + +G P + IG Sbjct: 104 LAGRTRKYKVIFSPQKFYACEMVLEEEGIYGDVSCDEWAFSLLPLDVDLLSMELPEFFRDYFLEGDQRWINTVAQALHLLSTLYGPFPNCYGIG 197 The following BLAST results are available for this feature:
BLAST of TCONS_00069318-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|