Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00003934-protein ID=TCONS_00003934-protein|Name=TCONS_00003934-protein|organism=Clytia hemisphaerica|type=polypeptide|length=104bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00003934-protein vs. Swiss-Prot (Human)
Match: UBAD2 (UBA-like domain-containing protein 2 OS=Homo sapiens GN=UBALD2 PE=1 SV=1) HSP 1 Score: 115.931 bits (289), Expect = 2.098e-34 Identity = 54/84 (64.29%), Postives = 66/84 (78.57%), Query Frame = 0 Query: 1 MEGLREQVMINQFIMAAGCAREQAKQILQASQWQFEAALSIYFQE--VPVAHPSHSAVAAPTNTPATPPNFPDALLAFSKLKTS 82 M+ LR QVMINQF++AAGCA +QAKQ+LQA+ WQFE ALS +FQE +P +H H + P+NTPATPPNFPDAL FSKL+ S Sbjct: 5 MDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPATPPNFPDALAMFSKLRAS 88 The following BLAST results are available for this feature:
BLAST of TCONS_00003934-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|