Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00004254-protein ID=TCONS_00004254-protein|Name=TCONS_00004254-protein|organism=Clytia hemisphaerica|type=polypeptide|length=270bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00004254-protein vs. Swiss-Prot (Human)
Match: GTSF1 (Gametocyte-specific factor 1 OS=Homo sapiens GN=GTSF1 PE=1 SV=2) HSP 1 Score: 85.1149 bits (209), Expect = 2.494e-20 Identity = 43/118 (36.44%), Postives = 64/118 (54.24%), Query Frame = 0 Query: 7 DPNGSLVCPFDPLHIISVKRYQYHIIKCRKNHPN--KDFVPCPFNAKHVVLRPELKTHIAHCPNRVVLEHDIMKEQCPETGESYRLKGKTDIPRGNYHVPETDENWDDEIEESITQRF 122 DP L CP+D H I R+ YH+IKCRKNHP+ CPFNA+H V R E+ HI+ C +R +E D++ ++ L+ +T + + P DE+WD ++ E + F Sbjct: 10 DPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVV-------NQTRSLRQET-LAESTWQCPPCDEDWDKDLWEQTSTPF 119 The following BLAST results are available for this feature:
BLAST of TCONS_00004254-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|